PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g092930.1
Common NameMTR_7g092930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 338aa    MW: 36441.2 Da    PI: 9.0673
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g092930.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.86.5e-4367143177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +CqvegC+ dl++ak y++rhkvC++hsk+p+v+vsgl+qrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+ 
  Medtr7g092930.1  67 RCQVEGCKLDLTDAKAYYSRHKVCSMHSKSPTVTVSGLQQRFCQQCSRFHQLAEFDQGKRSCRRRLAGHNERRRKPP 143
                      6**************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-3561129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.32565142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.11E-4166147IPR004333Transcription factor, SBP-box
PfamPF031109.3E-3368141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDSGGNSSSE ESSLNGLKFG QRIYFEDTAL TAASAAAAST TIAAGSPSSS GSKKGRGGSV  60
QHSQPPRCQV EGCKLDLTDA KAYYSRHKVC SMHSKSPTVT VSGLQQRFCQ QCSRFHQLAE  120
FDQGKRSCRR RLAGHNERRR KPPPSSLLTS RFARLSSSVF GNSDRGGSFL MEFASNPKHS  180
LRNSPGNQTT AIGWPWPGNT ESPSSNLFLQ GSVGGTSFPG ARHPPEETYT GVTDSNCALS  240
LLSNQTWGSQ NTEPSPGLNN MLNFNGTPMT QLGTSSHGVA MHQIPNNYEV VPDLGRGHIL  300
HPLGSQHSGE LDLLQQGRRH YMDVEHSRAY ESSQWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-32681411184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1578910.0AC157891.3 Medicago truncatula chromosome 7 clone mte1-1i2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625236.10.0squamosa promoter-binding-like protein
SwissprotQ700W24e-64SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLG7KVB20.0G7KVB2_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA19G32800.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-62squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Aung B, et al.
    MicroRNA156 as a promising tool for alfalfa improvement.
    Plant Biotechnol. J., 2015. 13(6): p. 779-90
    [PMID:25532560]